PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00138127001
Common NameGSBRNA2T00138127001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 103aa    MW: 12266 Da    PI: 10.4987
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00138127001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof95.53.7e-302278662
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         + cprC+s+ntkfCyynnys+sqPry   +CrryWt G alrn+P+ g+ rk k+++
  GSBRNA2T00138127001 22 RVCPRCNSKNTKFCYYNNYSVSQPRYKYNNCRRYWTDGRALRNIPIFGSGRKIKRTQ 78
                         67********************************************99999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-182076IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.0642276IPR003851Zinc finger, Dof-type
PfamPF027015.3E-262276IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MENLNVCVKR HTQLNEEKLP LRVCPRCNSK NTKFCYYNNY SVSQPRYKYN NCRRYWTDGR  60
ALRNIPIFGS GRKIKRTQRD QPSVEIQQVN HHQPFSHVPK NQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00138127001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137161.13e-43PREDICTED: dof zinc finger protein DOF4.4-like isoform X1
RefseqXP_013670317.13e-43PREDICTED: dof zinc finger protein DOF4.4-like
RefseqXP_013741408.13e-43PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA94e-31DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078D3F31e-71A0A078D3F3_BRANA; BnaC01g12440D protein
TrEMBLA0A0D3A4R01e-71A0A0D3A4R0_BRAOL; Uncharacterized protein
STRINGBra038789.1-P9e-43(Brassica rapa)
STRINGBra013493.1-P3e-42(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.13e-32Dof-type zinc finger domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]